PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g02470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family HB-other
Protein Properties Length: 935aa    MW: 103673 Da    PI: 9.5485
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g02470genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.95.5e-0667123157
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                +r+R  ++++ ++ L+++F+ +  +s++e +e+++  g++ +qV+ +F  ++++ ++
  Tp6g02470  67 KRPRDLLNPKAVKYLQAVFAIKDSISKTESREISALFGISVAQVRDFFVTQKTRVRR 123
                799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.49164124IPR001356Homeobox domain
SMARTSM003892.0E-466128IPR001356Homeobox domain
SuperFamilySSF466891.15E-567128IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-467126IPR009057Homeodomain-like
CDDcd000866.35E-467124No hitNo description
Gene3DG3DSA:1.20.930.105.2E-5230320IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476761.41E-5232316IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 935 aa     Download sequence    Send to blast
MDDAFKEEIE IGSSVESLME LLDSQKDIFH SQIDQLQDVV VTQCKLTGVN PLAQEMAAGA  60
LSIKIGKRPR DLLNPKAVKY LQAVFAIKDS ISKTESREIS ALFGISVAQV RDFFVTQKTR  120
VRRQVRLSRE KVICSSTLAI QGDDVPEKNN AVPHADPVPL NSMDPKASSI SWGEGETVAL  180
MPKEDIPPDI SDSDKYFVEN IFSLLRKEET FLGQVKLMEW IMQIQDSSVL IWFLSKGGVL  240
ILTTWLSQAA SEEQTSVLLL ILKVLCHLPL HKASPENMSA ILQSVNGLRF YRTSDISNRA  300
KGLLSRWTKL FAKIQAMKKQ NRNISQIDSQ SQLLLKQSIA EIMGDSSNPE DILSISNGRS  360
ENGRRFKLSQ GPKLLITSAD DSTRKHVLGS TPSYNKERRK VQMVEQPGQK AAGRSPQTVR  420
IGTSSQSRPM SADDIQKAKM RALYMHSKNS KKDPLPSAIG DTKTIVPEKP LALQSAKDSP  480
PSQNSEAKAE DTPEPSAVQP VNSLAVNLPV QAINSPAVNV PAQPVNSPAV NVPVQACEFR  540
KLSTPPKRIS SNVVVLLKMS PQTILKNCKR KQIDWHVPPG MALDELWRVA AGGNSKEADV  600
QKNRNRREKE TTYQSLQTIP LNPKEPWDRE MDFDDSLTPE IPSQQPPEES ITEPHDSLDE  660
RRTTAGAATT SSSQSSSVEP DFELLAALLK NPDLLYALTS GKPSNLASQD MVKLLDVIKT  720
GAPNSSSSLY KKVEEKVEVS LPSPTPSSNP GMSGWGEGVI RNPFSRQNQV GAAVARMSTQ  780
LPAASMQWQS SNEQLIPRHA LSAYNSLTLP HTERQHQHQT MQPRLHQSHQ QQPILTTSYG  840
VRESVGQMGI AASASWRSQQ SQNSYYTHQA NGIGPASYQV NDQYMSSNPG FESWSPDRSP  900
TRNHPNMRGQ QQQQQPSRKH DSSSHPYWNQ NKRWR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006396467.10.0hypothetical protein EUTSA_v10028403mg
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLV4KJ890.0V4KJ89_EUTSA; Uncharacterized protein
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein